SCOPe 2.08: Domain d2me6a1: 2me6 A:2-71

Lineage for d2me6a1 (2me6 A:2-71)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries)

8. Domain d2me6a1: 2me6 A:2-71 [243179]
   Other proteins in same PDB: d2me6a2
   automated match to d1ftza_
   protein/DNA complex

Details for d2me6a1

PDB Entry: 2me6

PDB Description: nmr structure of the homeodomain transcription factor gbx1 from homo sapiens in complex with the dna sequence cgactaattagtcg

PDB Compounds: (A:) Homeobox protein GBX-1

SCOPe Domain Sequences for d2me6a1:

Sequence; same for both SEQRES and ATOM records:

>d2me6a1 a.4.1.0 (A:2-71) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apggksrrrrtaftseqllelekefhckkylsltersqiahalklsevqvkiwfqnrrak
wkrikagnvs

Timeline for d2me6a1:

• d2me6a1 first appeared in SCOPe 2.04, called d2me6a_
  
• d2me6a1 appears in SCOPe 2.07