Lineage for d2me6a1 (2me6 A:2-71)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692777Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries)
  8. 2692795Domain d2me6a1: 2me6 A:2-71 [243179]
    Other proteins in same PDB: d2me6a2
    automated match to d1ftza_
    protein/DNA complex

Details for d2me6a1

PDB Entry: 2me6 (more details)

PDB Description: nmr structure of the homeodomain transcription factor gbx1 from homo sapiens in complex with the dna sequence cgactaattagtcg
PDB Compounds: (A:) Homeobox protein GBX-1

SCOPe Domain Sequences for d2me6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2me6a1 a.4.1.0 (A:2-71) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apggksrrrrtaftseqllelekefhckkylsltersqiahalklsevqvkiwfqnrrak
wkrikagnvs

SCOPe Domain Coordinates for d2me6a1:

Click to download the PDB-style file with coordinates for d2me6a1.
(The format of our PDB-style files is described here.)

Timeline for d2me6a1: