Lineage for d2me0a1 (2me0 A:2-71)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982467Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982468Protein automated matches [190674] (22 species)
    not a true protein
  7. 1982516Species Human (Homo sapiens) [TaxId:9606] [189258] (25 PDB entries)
  8. 1982534Domain d2me0a1: 2me0 A:2-71 [243178]
    Other proteins in same PDB: d2me0a2
    automated match to d1ftza_

Details for d2me0a1

PDB Entry: 2me0 (more details)

PDB Description: nmr structure of the homeodomain transcription factor gbx1 from homo sapiens solved in the presence of the dna sequence cgactaattagtcg
PDB Compounds: (A:) Homeobox protein GBX-1

SCOPe Domain Sequences for d2me0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2me0a1 a.4.1.0 (A:2-71) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apggksrrrrtaftseqllelekefhckkylsltersqiahalklsevqvkiwfqnrrak
wkrikagnvs

SCOPe Domain Coordinates for d2me0a1:

Click to download the PDB-style file with coordinates for d2me0a1.
(The format of our PDB-style files is described here.)

Timeline for d2me0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2me0a2