SCOPe 2.05: Domain d2me0a_: 2me0 A:

Lineage for d2me0a_ (2me0 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189258] (22 PDB entries)

8. Domain d2me0a_: 2me0 A: [243178]
   automated match to d1ftza_

Details for d2me0a_

PDB Entry: 2me0

PDB Description: nmr structure of the homeodomain transcription factor gbx1 from homo sapiens solved in the presence of the dna sequence cgactaattagtcg

PDB Compounds: (A:) Homeobox protein GBX-1

SCOPe Domain Sequences for d2me0a_:

Sequence; same for both SEQRES and ATOM records:

>d2me0a_ a.4.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sapggksrrrrtaftseqllelekefhckkylsltersqiahalklsevqvkiwfqnrra
kwkrikagnvs

Timeline for d2me0a_:

• d2me0a_ first appeared in SCOPe 2.04
  
• d2me0a_ is called d2me0a1 in SCOPe 2.06
  
• d2me0a_ appears in the current release, SCOPe 2.08, called d2me0a1