PDB entry 2me0

View 2me0 on RCSB PDB site
Description: NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens solved in the presence of the DNA sequence CGACTAATTAGTCG
Class: transcription
Keywords: Homeodomain, DNA binding, TRANSCRIPTION
Deposited on 2013-09-20, released 2013-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein GBX-1
    Species: Homo sapiens [TaxId:9606]
    Gene: GBX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14549 (1-70)
      • expression tag (0)
    Domains in SCOPe 2.06: d2me0a1, d2me0a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2me0A (A:)
    sapggksrrrrtaftseqllelekefhckkylsltersqiahalklsevqvkiwfqnrra
    kwkrikagnvs