| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
| Protein automated matches [190674] (25 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries) |
| Domain d2me0a1: 2me0 A:2-71 [243178] Other proteins in same PDB: d2me0a2 automated match to d1ftza_ |
PDB Entry: 2me0 (more details)
SCOPe Domain Sequences for d2me0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2me0a1 a.4.1.0 (A:2-71) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apggksrrrrtaftseqllelekefhckkylsltersqiahalklsevqvkiwfqnrrak
wkrikagnvs
Timeline for d2me0a1: