SCOPe 2.08: Domain d2m3la1: 2m3l A:80-151

Lineage for d2m3la1 (2m3l A:80-151)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.90: E6 C-terminal domain-like [161228] (1 superfamily)
   alpha+beta zinc-binding fold with topological similarity to the fold of lambda cro protein

4. Superfamily g.90.1: E6 C-terminal domain-like [161229] (1 family)
   automatically mapped to Pfam PF00518

5. Family g.90.1.1: E6 C-terminal domain-like [161230] (2 proteins)
   C-terminal part of Pfam PF00518

6. Protein automated matches [254600] (2 species)
   not a true protein

7. Species Human papillomavirus type 51 [TaxId:10595] [255477] (1 PDB entry)

8. Domain d2m3la1: 2m3l A:80-151 [243091]
   Other proteins in same PDB: d2m3la2
   automated match to d2fk4a1
   complexed with zn

Details for d2m3la1

PDB Entry: 2m3l

PDB Description: Solution structure of the C-terminal zinc-binding domain of HPV51 oncoprotein E6

PDB Compounds: (A:) Protein E6

SCOPe Domain Sequences for d2m3la1:

Sequence; same for both SEQRES and ATOM records:

>d2m3la1 g.90.1.1 (A:80-151) automated matches {Human papillomavirus type 51 [TaxId: 10595]}
srsvygttleaitkkslydlsirchrcqrplgpeekqklvdekkrfheiagrwtgqcanc
wqrtrqrnetqv

Timeline for d2m3la1:

• d2m3la1 first appeared in SCOPe 2.04, called d2m3la_
  
• d2m3la1 appears in SCOPe 2.07