![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.90: E6 C-terminal domain-like [161228] (1 superfamily) alpha+beta zinc-binding fold with topological similarity to the fold of lambda cro protein |
![]() | Superfamily g.90.1: E6 C-terminal domain-like [161229] (1 family) ![]() automatically mapped to Pfam PF00518 |
![]() | Family g.90.1.1: E6 C-terminal domain-like [161230] (2 proteins) C-terminal part of Pfam PF00518 |
![]() | Protein E6 oncoprotein [161231] (1 species) |
![]() | Species Human papillomavirus type 16 [TaxId:333760] [161232] (1 PDB entry) Uniprot P03126 88-151 |
![]() | Domain d2fk4a1: 2fk4 A:3-67 [147040] Other proteins in same PDB: d2fk4a2 complexed with zn |
PDB Entry: 2fk4 (more details)
SCOPe Domain Sequences for d2fk4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fk4a1 g.90.1.1 (A:3-67) E6 oncoprotein {Human papillomavirus type 16 [TaxId: 333760]} syslygttleqqynkplsdllircincqkplspeekqrhldkkqrfhnirgrwtgrcmsc srssr
Timeline for d2fk4a1: