Lineage for d2fk4a1 (2fk4 A:3-67)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.90: E6 C-terminal domain-like [161228] (1 superfamily)
alpha+beta zinc-binding fold with topological similarity to the fold of lambda cro proteinSuperfamily g.90.1: E6 C-terminal domain-like [161229] (1 family) 
automatically mapped to Pfam PF00518Family g.90.1.1: E6 C-terminal domain-like [161230] (2 proteins)
C-terminal part of Pfam PF00518Protein E6 oncoprotein [161231] (1 species) Species Human papillomavirus type 16 [TaxId:333760] [161232] (1 PDB entry)
Uniprot P03126 88-151
Domain d2fk4a1: 2fk4 A:3-67 [147040]
Other proteins in same PDB: d2fk4a2
complexed with zn
Details for d2fk4a1
PDB Entry: 2fk4 (more details)
PDB Description: solution structure of the c-terminal zinc binding domain of the hpv16 e6 oncoprotein
PDB Compounds: (A:) Protein E6SCOPe Domain Sequences for d2fk4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fk4a1 g.90.1.1 (A:3-67) E6 oncoprotein {Human papillomavirus type 16 [TaxId: 333760]}
syslygttleqqynkplsdllircincqkplspeekqrhldkkqrfhnirgrwtgrcmsc
srssr
SCOPe Domain Coordinates for d2fk4a1:
Click to download the PDB-style file with coordinates for d2fk4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fk4a1:
- d2fk4a1 first appeared in SCOP 1.75
- d2fk4a1 appears in SCOPe 2.07
View in 3D
