Lineage for d2fk4a1 (2fk4 A:4-67)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894709Fold g.90: E6 C-terminal domain-like [161228] (1 superfamily)
    alpha+beta zinc-binding fold with topological similarity to the fold of lambda cro protein
  4. 894710Superfamily g.90.1: E6 C-terminal domain-like [161229] (1 family) (S)
  5. 894711Family g.90.1.1: E6 C-terminal domain-like [161230] (1 protein)
    C-terminal part of Pfam PF00518
  6. 894712Protein E6 oncoprotein [161231] (1 species)
  7. 894713Species Human papillomavirus type 16 [TaxId:333760] [161232] (1 PDB entry)
    Uniprot P03126 88-151
  8. 894714Domain d2fk4a1: 2fk4 A:4-67 [147040]
    complexed with zn; mutant

Details for d2fk4a1

PDB Entry: 2fk4 (more details)

PDB Description: solution structure of the c-terminal zinc binding domain of the hpv16 e6 oncoprotein
PDB Compounds: (A:) Protein E6

SCOP Domain Sequences for d2fk4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk4a1 g.90.1.1 (A:4-67) E6 oncoprotein {Human papillomavirus type 16 [TaxId: 333760]}
yslygttleqqynkplsdllircincqkplspeekqrhldkkqrfhnirgrwtgrcmscs
rssr

SCOP Domain Coordinates for d2fk4a1:

Click to download the PDB-style file with coordinates for d2fk4a1.
(The format of our PDB-style files is described here.)

Timeline for d2fk4a1: