PDB entry 2fk4

View 2fk4 on RCSB PDB site
Description: Solution structure of the C-terminal zinc binding domain of the HPV16 E6 oncoprotein
Class: Metal binding protein, Oncoprotein
Keywords: ZINC BINDING DOMAIN, ONCOPROTEIN, Metal binding protein
Deposited on 2006-01-04, released 2006-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein E6
    Species: Human papillomavirus type 16 [TaxId:333760]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03126 (3-End)
      • cloning artifact (1-2)
      • engineered (3)
      • engineered (20)
      • engineered (34)
      • engineered (63)
    Domains in SCOPe 2.08: d2fk4a1, d2fk4a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fk4A (A:)
    gamsyslygttleqqynkplsdllircincqkplspeekqrhldkkqrfhnirgrwtgrc
    mscsrssrtrretql
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk4A (A:)
    amsyslygttleqqynkplsdllircincqkplspeekqrhldkkqrfhnirgrwtgrcm
    scsrssr