Lineage for d2m3la1 (2m3l A:80-151)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643603Fold g.90: E6 C-terminal domain-like [161228] (1 superfamily)
    alpha+beta zinc-binding fold with topological similarity to the fold of lambda cro protein
  4. 2643604Superfamily g.90.1: E6 C-terminal domain-like [161229] (1 family) (S)
    automatically mapped to Pfam PF00518
  5. 2643605Family g.90.1.1: E6 C-terminal domain-like [161230] (2 proteins)
    C-terminal part of Pfam PF00518
  6. 2643609Protein automated matches [254600] (2 species)
    not a true protein
  7. 2643610Species Human papillomavirus type 51 [TaxId:10595] [255477] (1 PDB entry)
  8. 2643611Domain d2m3la1: 2m3l A:80-151 [243091]
    Other proteins in same PDB: d2m3la2
    automated match to d2fk4a1
    complexed with zn

Details for d2m3la1

PDB Entry: 2m3l (more details)

PDB Description: Solution structure of the C-terminal zinc-binding domain of HPV51 oncoprotein E6
PDB Compounds: (A:) Protein E6

SCOPe Domain Sequences for d2m3la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m3la1 g.90.1.1 (A:80-151) automated matches {Human papillomavirus type 51 [TaxId: 10595]}
srsvygttleaitkkslydlsirchrcqrplgpeekqklvdekkrfheiagrwtgqcanc
wqrtrqrnetqv

SCOPe Domain Coordinates for d2m3la1:

Click to download the PDB-style file with coordinates for d2m3la1.
(The format of our PDB-style files is described here.)

Timeline for d2m3la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2m3la2