SCOPe 2.04: Domain d2m3la_: 2m3l A:

Lineage for d2m3la_ (2m3l A:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.90: E6 C-terminal domain-like [161228] (1 superfamily)
   alpha+beta zinc-binding fold with topological similarity to the fold of lambda cro protein

4. Superfamily g.90.1: E6 C-terminal domain-like [161229] (1 family)
   automatically mapped to Pfam PF00518

5. Family g.90.1.1: E6 C-terminal domain-like [161230] (2 proteins)
   C-terminal part of Pfam PF00518

6. Protein automated matches [254600] (2 species)
   not a true protein

7. Species Human papillomavirus type 51 [TaxId:10595] [255477] (1 PDB entry)

8. Domain d2m3la_: 2m3l A: [243091]
   automated match to d2fk4a1
   complexed with zn

Details for d2m3la_

PDB Entry: 2m3l

PDB Description: Solution structure of the C-terminal zinc-binding domain of HPV51 oncoprotein E6

PDB Compounds: (A:) Protein E6

SCOPe Domain Sequences for d2m3la_:

Sequence; same for both SEQRES and ATOM records:

>d2m3la_ g.90.1.1 (A:) automated matches {Human papillomavirus type 51 [TaxId: 10595]}
gshmsrsvygttleaitkkslydlsirchrcqrplgpeekqklvdekkrfheiagrwtgq
cancwqrtrqrnetqv

Timeline for d2m3la_:

• d2m3la_ is new in SCOPe 2.04-stable
  
• d2m3la_ appears in SCOPe 2.05
  
• d2m3la_ appears in the current release, SCOPe 2.08, called d2m3la1