Lineage for d2lf7a1 (2lf7 A:335-436)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694909Species Mouse (Mus musculus) [TaxId:10090] [189892] (3 PDB entries)
  8. 2694914Domain d2lf7a1: 2lf7 A:335-436 [242868]
    Other proteins in same PDB: d2lf7a2
    automated match to d4avpa_

Details for d2lf7a1

PDB Entry: 2lf7 (more details)

PDB Description: Intramolecular regulation of the ETS Domain within ETV6 sequence R335 to Q436
PDB Compounds: (A:) transcription factor etv6

SCOPe Domain Sequences for d2lf7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lf7a1 a.4.5.0 (A:335-436) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rllwdyvyqllsdsryenfirwedkeskifrivdpnglarlwgnhknrtnmtyekmsral
rhyyklniirkepgqrllfrfmktpdeimsgrtdrlehlesq

SCOPe Domain Coordinates for d2lf7a1:

Click to download the PDB-style file with coordinates for d2lf7a1.
(The format of our PDB-style files is described here.)

Timeline for d2lf7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lf7a2