SCOPe 2.07: Domain d2lf7a1: 2lf7 A:335-436

Lineage for d2lf7a1 (2lf7 A:335-436)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189892] (3 PDB entries)

8. Domain d2lf7a1: 2lf7 A:335-436 [242868]
   Other proteins in same PDB: d2lf7a2
   automated match to d4avpa_

Details for d2lf7a1

PDB Entry: 2lf7

PDB Description: Intramolecular regulation of the ETS Domain within ETV6 sequence R335 to Q436

PDB Compounds: (A:) transcription factor etv6

SCOPe Domain Sequences for d2lf7a1:

Sequence; same for both SEQRES and ATOM records:

>d2lf7a1 a.4.5.0 (A:335-436) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rllwdyvyqllsdsryenfirwedkeskifrivdpnglarlwgnhknrtnmtyekmsral
rhyyklniirkepgqrllfrfmktpdeimsgrtdrlehlesq

Timeline for d2lf7a1:

• d2lf7a1 first appeared in SCOPe 2.04, called d2lf7a_
  
• d2lf7a1 appears in SCOPe 2.06
  
• d2lf7a1 appears in the current release, SCOPe 2.08