SCOPe 2.08: Domain d2l6ea1: 2l6e A:148-231

Lineage for d2l6ea1 (2l6e A:148-231)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein automated matches [226861] (4 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (6 PDB entries)

8. Domain d2l6ea1: 2l6e A:148-231 [242789]
   Other proteins in same PDB: d2l6ea2
   automated match to d2xt1a_
   mutant

Details for d2l6ea1

PDB Entry: 2l6e

PDB Description: NMR Structure of the monomeric mutant C-terminal domain of HIV-1 Capsid in complex with stapled peptide Inhibitor

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d2l6ea1:

Sequence; same for both SEQRES and ATOM records:

>d2l6ea1 a.28.3.1 (A:148-231) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
aatleemmtacqgvggpghkarvl

Timeline for d2l6ea1:

• d2l6ea1 first appeared in SCOPe 2.04, called d2l6ea_
  
• d2l6ea1 appears in SCOPe 2.07