Lineage for d2l6ea1 (2l6e A:148-231)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706466Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 2706520Protein automated matches [226861] (4 species)
    not a true protein
  7. 2706524Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (6 PDB entries)
  8. 2706534Domain d2l6ea1: 2l6e A:148-231 [242789]
    Other proteins in same PDB: d2l6ea2
    automated match to d2xt1a_
    mutant

Details for d2l6ea1

PDB Entry: 2l6e (more details)

PDB Description: NMR Structure of the monomeric mutant C-terminal domain of HIV-1 Capsid in complex with stapled peptide Inhibitor
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d2l6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l6ea1 a.28.3.1 (A:148-231) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
aatleemmtacqgvggpghkarvl

SCOPe Domain Coordinates for d2l6ea1:

Click to download the PDB-style file with coordinates for d2l6ea1.
(The format of our PDB-style files is described here.)

Timeline for d2l6ea1: