PDB entry 2l6e

View 2l6e on RCSB PDB site
Description: NMR Structure of the monomeric mutant C-terminal domain of HIV-1 Capsid in complex with stapled peptide Inhibitor
Class: viral protein/inhibitor
Keywords: Protein-stapled peptide complex, VIRAL PROTEIN - PEPTIDE INHIBITOR complex, VIRAL PROTEIN-INHIBITOR complex
Deposited on 2010-11-18, released 2010-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: capsid protein p24
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: GAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35963 (21-104)
    • expression tag (11-20)
    • engineered mutation (57-58)
  Domains in SCOPe 2.08: d2l6ea1, d2l6ea2
• Chain 'B':
  Compound: NYAD-13 stapled peptide inhibitor
  Database cross-references and differences (RAF-indexed):
  • PDB 2L6E (0-13)

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2l6eA (A:)
  mgsshhhhhhssglvprgshmtsildirqgpkepfrdyvdrfyktlraeqasqevknaat
  etllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2l6eA (A:)
  sglvprgshmtsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpd
  cktilkalgpaatleemmtacqgvggpghkarvl
  

  
  
• Chain 'B':
  No sequence available.