Lineage for d2l6ea_ (2l6e A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487597Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1487598Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 1487635Protein automated matches [226861] (3 species)
    not a true protein
  7. 1487639Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (6 PDB entries)
  8. 1487647Domain d2l6ea_: 2l6e A: [242789]
    automated match to d2xt1a_
    mutant

Details for d2l6ea_

PDB Entry: 2l6e (more details)

PDB Description: NMR Structure of the monomeric mutant C-terminal domain of HIV-1 Capsid in complex with stapled peptide Inhibitor
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d2l6ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l6ea_ a.28.3.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
sglvprgshmtsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpd
cktilkalgpaatleemmtacqgvggpghkarvl

SCOPe Domain Coordinates for d2l6ea_:

Click to download the PDB-style file with coordinates for d2l6ea_.
(The format of our PDB-style files is described here.)

Timeline for d2l6ea_: