PDB entry 2l6e
View 2l6e on RCSB PDB site
Description: NMR Structure of the monomeric mutant C-terminal domain of HIV-1 Capsid in complex with stapled peptide Inhibitor
Class: viral protein/inhibitor
Keywords: Protein-stapled peptide complex, VIRAL PROTEIN - PEPTIDE INHIBITOR complex, VIRAL PROTEIN-INHIBITOR complex
Deposited on
2010-11-18, released
2010-12-29
The last revision prior to the SCOPe 2.04 freeze date was dated
2010-12-29, with a file datestamp of
2010-12-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: capsid protein p24
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot P35963 (21-104)
- expression tag (11-20)
- engineered mutation (57-58)
Domains in SCOPe 2.04: d2l6ea_ - Chain 'B':
Compound: NYAD-13 stapled peptide inhibitor
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2l6eA (A:)
mgsshhhhhhssglvprgshmtsildirqgpkepfrdyvdrfyktlraeqasqevknaat
etllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvl
Sequence, based on observed residues (ATOM records): (download)
>2l6eA (A:)
sglvprgshmtsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpd
cktilkalgpaatleemmtacqgvggpghkarvl
- Chain 'B':
No sequence available.