Lineage for d2kvma_ (2kvm A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055542Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2055586Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2055663Protein automated matches [191035] (3 species)
    not a true protein
  7. 2055688Species Mouse (Mus musculus) [TaxId:10090] [255382] (5 PDB entries)
  8. 2055700Domain d2kvma_: 2kvm A: [242678]
    automated match to d3gv6a_

Details for d2kvma_

PDB Entry: 2kvm (more details)

PDB Description: solution structure of the cbx7 chromodomain in complex with a h3k27me2 peptide
PDB Compounds: (A:) Chromobox protein homolog 7

SCOPe Domain Sequences for d2kvma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kvma_ b.34.13.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
melsaigeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeek
eerdrasgyrk

SCOPe Domain Coordinates for d2kvma_:

Click to download the PDB-style file with coordinates for d2kvma_.
(The format of our PDB-style files is described here.)

Timeline for d2kvma_: