PDB entry 2kvm

View 2kvm on RCSB PDB site
Description: Solution structure of the CBX7 chromodomain in complex with a H3K27me2 peptide
Class: transcription
Keywords: histone modification, lysine methylation, chromobox, polycomb, chromatin-binding, Chromatin regulator, Nucleus, Repressor, Transcription, Transcription regulation
Deposited on 2010-03-17, released 2010-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chromobox protein homolog 7
  Species: Mus musculus [TaxId:10090]
  Gene: Cbx7, D15Ertd417e
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8VDS3 (3-73)
  Domains in SCOPe 2.06: d2kvma_
• Chain 'B':
  Compound: histone H3 peptide (residues 15-30) with dimethylated lysine 27
  Database cross-references and differences (RAF-indexed):
  • PDB 2KVM (0-15)

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2kvmA (A:)
  gshmelsaigeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmay
  eekeerdrasgyrk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2kvmA (A:)
  melsaigeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeek
  eerdrasgyrk
  

  
  
• Chain 'B':
  No sequence available.