PDB entry 2kvm

View 2kvm on RCSB PDB site
Description: Solution structure of the CBX7 chromodomain in complex with a H3K27me2 peptide
Class: transcription
Keywords: histone modification, lysine methylation, chromobox, polycomb, chromatin-binding, Chromatin regulator, Nucleus, Repressor, Transcription, Transcription regulation
Deposited on 2010-03-17, released 2010-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 7
    Species: Mus musculus [TaxId:10090]
    Gene: Cbx7, D15Ertd417e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2kvma_
  • Chain 'B':
    Compound: histone H3 peptide (residues 15-30) with dimethylated lysine 27
    Database cross-references and differences (RAF-indexed):
    • PDB 2KVM (0-15)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kvmA (A:)
    gshmelsaigeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmay
    eekeerdrasgyrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kvmA (A:)
    melsaigeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeek
    eerdrasgyrk
    

  • Chain 'B':
    No sequence available.