SCOPe 2.06: Domain d2ktda1: 2ktd A:25-189

Lineage for d2ktda1 (2ktd A:25-189)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (21 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225136] (5 PDB entries)

8. Domain d2ktda1: 2ktd A:25-189 [242647]
   Other proteins in same PDB: d2ktda2
   automated match to d1gm6a_
   complexed with puc

Details for d2ktda1

PDB Entry: 2ktd

PDB Description: Solution structure of mouse lipocalin-type prostaglandin D synthase / substrate analog (U-46619) complex

PDB Compounds: (A:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d2ktda1:

Sequence; same for both SEQRES and ATOM records:

>d2ktda1 b.60.1.0 (A:25-189) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qghdtvqpnfqqdkflgrwysaglasnsswfrekkavlymcktvvapstegglnltstfl
rknqaetkimvlqpagapghytyssphsgsihsvsvveanydeyallfsrgtkgpgqdfr
matlysrtqtlkdelkekfttfskaqglteedivflpqpdkaiqe

Timeline for d2ktda1:

• d2ktda1 first appeared in SCOPe 2.04, called d2ktda_
  
• d2ktda1 was called d2ktda_ in SCOPe 2.05
  
• d2ktda1 appears in SCOPe 2.07
  
• d2ktda1 appears in the current release, SCOPe 2.08