SCOPe 2.05: Domain d2ktda_: 2ktd A:

Lineage for d2ktda_ (2ktd A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225136] (5 PDB entries)

8. Domain d2ktda_: 2ktd A: [242647]
   automated match to d1gm6a_
   complexed with puc

Details for d2ktda_

PDB Entry: 2ktd

PDB Description: Solution structure of mouse lipocalin-type prostaglandin D synthase / substrate analog (U-46619) complex

PDB Compounds: (A:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d2ktda_:

Sequence; same for both SEQRES and ATOM records:

>d2ktda_ b.60.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsqghdtvqpnfqqdkflgrwysaglasnsswfrekkavlymcktvvapstegglnltst
flrknqaetkimvlqpagapghytyssphsgsihsvsvveanydeyallfsrgtkgpgqd
frmatlysrtqtlkdelkekfttfskaqglteedivflpqpdkaiqe

Timeline for d2ktda_:

• d2ktda_ first appeared in SCOPe 2.04
  
• d2ktda_ is called d2ktda1 in SCOPe 2.06
  
• d2ktda_ appears in the current release, SCOPe 2.08, called d2ktda1