Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (25 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225136] (5 PDB entries) |
Domain d2ktda1: 2ktd A:25-189 [242647] Other proteins in same PDB: d2ktda2 automated match to d1gm6a_ complexed with puc |
PDB Entry: 2ktd (more details)
SCOPe Domain Sequences for d2ktda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ktda1 b.60.1.0 (A:25-189) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qghdtvqpnfqqdkflgrwysaglasnsswfrekkavlymcktvvapstegglnltstfl rknqaetkimvlqpagapghytyssphsgsihsvsvveanydeyallfsrgtkgpgqdfr matlysrtqtlkdelkekfttfskaqglteedivflpqpdkaiqe
Timeline for d2ktda1: