PDB entry 2ktd

View 2ktd on RCSB PDB site
Description: Solution structure of mouse lipocalin-type prostaglandin D synthase / substrate analog (U-46619) complex
Class: isomerase
Keywords: lipocalin-type prostaglandin D synthase, L-PGDS, Prostaglandin H2, Prostaglandin D2, U-46619, lipocalin, Disulfide bond, Endoplasmic reticulum, Fatty acid biosynthesis, Glycoprotein, Golgi apparatus, Isomerase, Lipid synthesis, Nucleus, Prostaglandin biosynthesis, Pyrrolidone carboxylic acid, Secreted, Transport
Deposited on 2010-01-27, released 2011-02-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Prostaglandin-H2 D-isomerase
  Species: Mus musculus [TaxId:10090]
  Gene: Ptgds
  Database cross-references and differences (RAF-indexed):
  • Uniprot O09114 (2-166)
    • expression tag (0-1)
    • engineered mutation (66)
    • engineered mutation (163)
  Domains in SCOPe 2.06: d2ktda1, d2ktda2
• Heterogens: PUC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ktdA (A:)
  gsqghdtvqpnfqqdkflgrwysaglasnsswfrekkavlymcktvvapstegglnltst
  flrknqaetkimvlqpagapghytyssphsgsihsvsvveanydeyallfsrgtkgpgqd
  frmatlysrtqtlkdelkekfttfskaqglteedivflpqpdkaiqe