Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries) |
Domain d2ki6d_: 2ki6 D: [242527] Other proteins in same PDB: d2ki6a_, d2ki6b_, d2ki6e_, d2ki6f_ automated match to d2h2ka_ |
PDB Entry: 2ki6 (more details)
SCOPe Domain Sequences for d2ki6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ki6d_ a.39.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm ksldvnqdselkfneywrligelakeirkkkdlkirkk
Timeline for d2ki6d_: