SCOPe 2.08: Domain d2ki6f_: 2ki6 F:

Lineage for d2ki6f_ (2ki6 F:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (3 species)
   duplication: contains tandem repeat of two similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries)

8. Domain d2ki6f_: 2ki6 F: [242529]
   Other proteins in same PDB: d2ki6b_, d2ki6c_, d2ki6d_, d2ki6e_
   automated match to d1byna_

Details for d2ki6f_

PDB Entry: 2ki6

PDB Description: The FGF1-S100A13-C2A hetero-hexameric complex structure: A component in the non-classical pathway for FGF1 secretion

PDB Compounds: (F:) Synaptotagmin-1

SCOPe Domain Sequences for d2ki6f_:

Sequence; same for both SEQRES and ATOM records:

>d2ki6f_ b.7.1.2 (F:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek

Timeline for d2ki6f_:

• d2ki6f_ first appeared in SCOPe 2.04
  
• d2ki6f_ appears in SCOPe 2.07