SCOPe 2.04: Domain d2k5oa_: 2k5o A:

Lineage for d2k5oa_ (2k5o A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234629] (12 PDB entries)

8. Domain d2k5oa_: 2k5o A: [242381]
   automated match to d1xyxa_
   mutant

Details for d2k5oa_

PDB Entry: 2k5o

PDB Description: mouse prion protein (121-231) with mutation s170n

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2k5oa_:

Sequence; same for both SEQRES and ATOM records:

>d2k5oa_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
svvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqynnqnnfvhdc
vnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss

Timeline for d2k5oa_:

• d2k5oa_ is new in SCOPe 2.04-stable
  
• d2k5oa_ appears in SCOPe 2.05
  
• d2k5oa_ appears in the current release, SCOPe 2.08, called d2k5oa1