SCOPe 2.08: Domain d2k5oa1: 2k5o A:121-232

Lineage for d2k5oa1 (2k5o A:121-232)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234629] (15 PDB entries)

8. Domain d2k5oa1: 2k5o A:121-232 [242381]
   Other proteins in same PDB: d2k5oa2
   automated match to d1xyxa_
   mutant

Details for d2k5oa1

PDB Entry: 2k5o

PDB Description: mouse prion protein (121-231) with mutation s170n

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2k5oa1:

Sequence; same for both SEQRES and ATOM records:

>d2k5oa1 d.6.1.1 (A:121-232) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqynnqnnfvhdcv
nitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss

Timeline for d2k5oa1:

• d2k5oa1 first appeared in SCOPe 2.04, called d2k5oa_
  
• d2k5oa1 appears in SCOPe 2.07