Lineage for d2k56a_ (2k56 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635622Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1635623Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1635624Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1635688Protein automated matches [191016] (6 species)
    not a true protein
  7. 1635717Species Myodes glareolus [TaxId:447135] [255321] (1 PDB entry)
  8. 1635718Domain d2k56a_: 2k56 A: [242380]
    automated match to d1y2sa_

Details for d2k56a_

PDB Entry: 2k56 (more details)

PDB Description: bank vole prion protein (121-231)
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2k56a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k56a_ d.6.1.1 (A:) automated matches {Myodes glareolus [TaxId: 447135]}
gsvvgglggymlgsamsrpmihfgndwedryyrenmnrypnqvyyrpvdqynnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayyegrss

SCOPe Domain Coordinates for d2k56a_:

Click to download the PDB-style file with coordinates for d2k56a_.
(The format of our PDB-style files is described here.)

Timeline for d2k56a_: