Lineage for d2k56a1 (2k56 A:121-231)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2498997Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2498998Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2498999Family d.6.1.1: Prion-like [54099] (3 protein domains)
  6. 2499063Protein automated matches [191016] (9 species)
    not a true protein
  7. 2499096Species Myodes glareolus [TaxId:447135] [255321] (1 PDB entry)
  8. 2499097Domain d2k56a1: 2k56 A:121-231 [242380]
    Other proteins in same PDB: d2k56a2
    automated match to d1y2sa_

Details for d2k56a1

PDB Entry: 2k56 (more details)

PDB Description: Bank Vole Prion Protein (121-231)
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2k56a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k56a1 d.6.1.1 (A:121-231) automated matches {Myodes glareolus [TaxId: 447135]}
vvgglggymlgsamsrpmihfgndwedryyrenmnrypnqvyyrpvdqynnqnnfvhdcv
nitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayyegrss

SCOPe Domain Coordinates for d2k56a1:

Click to download the PDB-style file with coordinates for d2k56a1.
(The format of our PDB-style files is described here.)

Timeline for d2k56a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k56a2