![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
![]() | Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
![]() | Family d.6.1.1: Prion-like [54099] (3 proteins) |
![]() | Protein automated matches [191016] (9 species) not a true protein |
![]() | Species Myodes glareolus [TaxId:447135] [255321] (1 PDB entry) |
![]() | Domain d2k56a1: 2k56 A:121-231 [242380] Other proteins in same PDB: d2k56a2 automated match to d1y2sa_ |
PDB Entry: 2k56 (more details)
SCOPe Domain Sequences for d2k56a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k56a1 d.6.1.1 (A:121-231) automated matches {Myodes glareolus [TaxId: 447135]} vvgglggymlgsamsrpmihfgndwedryyrenmnrypnqvyyrpvdqynnqnnfvhdcv nitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayyegrss
Timeline for d2k56a1: