PDB entry 2k56

View 2k56 on RCSB PDB site
Description: Bank Vole Prion Protein (121-231)
Class: unknown function
Keywords: Prion Protein, Membrane, UNKNOWN FUNCTION
Deposited on 2008-06-26, released 2008-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: Myodes glareolus [TaxId:447135]
  Gene: PrP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8VHV5 (2-112)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d2k56a1, d2k56a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k56A (A:)
  gsvvgglggymlgsamsrpmihfgndwedryyrenmnrypnqvyyrpvdqynnqnnfvhd
  cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayyegrss