SCOPe 2.07: Domain d2jo0a1: 2jo0 A:2-87

Lineage for d2jo0a1 (2jo0 A:2-87)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein HIV capsid protein, dimerisation domain [47359] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (15 PDB entries)

8. Domain d2jo0a1: 2jo0 A:2-87 [242253]
   Other proteins in same PDB: d2jo0a2
   automated match to d2xt1a_

Details for d2jo0a1

PDB Entry: 2jo0

PDB Description: the solution structure of the monomeric species of the c terminal domain of the ca protein of hiv-1

PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d2jo0a1:

Sequence; same for both SEQRES and ATOM records:

>d2jo0a1 a.28.3.1 (A:2-87) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sptsildirqgpkepfrdyvdrfyktlraeqasqevknamtetllvqnanpdcktilkal
gpaatleemmtacqgvggpghkarvl

Timeline for d2jo0a1:

• d2jo0a1 first appeared in SCOPe 2.04, called d2jo0a_
  
• d2jo0a1 appears in SCOPe 2.06
  
• d2jo0a1 appears in the current release, SCOPe 2.08