Lineage for d2jo0a_ (2jo0 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487597Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1487598Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 1487604Protein HIV capsid protein, dimerisation domain [47359] (1 species)
  7. 1487605Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (14 PDB entries)
  8. 1487626Domain d2jo0a_: 2jo0 A: [242253]
    automated match to d2xt1a_

Details for d2jo0a_

PDB Entry: 2jo0 (more details)

PDB Description: The solution structure of the monomeric species of the C terminal domain of the CA protein of HIV-1
PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d2jo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jo0a_ a.28.3.1 (A:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
msptsildirqgpkepfrdyvdrfyktlraeqasqevknamtetllvqnanpdcktilka
lgpaatleemmtacqgvggpghkarvl

SCOPe Domain Coordinates for d2jo0a_:

Click to download the PDB-style file with coordinates for d2jo0a_.
(The format of our PDB-style files is described here.)

Timeline for d2jo0a_: