![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
![]() | Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) |
![]() | Protein HIV capsid protein, dimerisation domain [47359] (3 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (13 PDB entries) |
![]() | Domain d2jo0a1: 2jo0 A:2-87 [242253] Other proteins in same PDB: d2jo0a2 automated match to d2xt1a_ |
PDB Entry: 2jo0 (more details)
SCOPe Domain Sequences for d2jo0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jo0a1 a.28.3.1 (A:2-87) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]} sptsildirqgpkepfrdyvdrfyktlraeqasqevknamtetllvqnanpdcktilkal gpaatleemmtacqgvggpghkarvl
Timeline for d2jo0a1: