Lineage for d2jo0a1 (2jo0 A:2-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706466Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 2706472Protein HIV capsid protein, dimerisation domain [47359] (3 species)
  7. 2706495Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (13 PDB entries)
  8. 2706511Domain d2jo0a1: 2jo0 A:2-87 [242253]
    Other proteins in same PDB: d2jo0a2
    automated match to d2xt1a_

Details for d2jo0a1

PDB Entry: 2jo0 (more details)

PDB Description: the solution structure of the monomeric species of the c terminal domain of the ca protein of hiv-1
PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d2jo0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jo0a1 a.28.3.1 (A:2-87) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sptsildirqgpkepfrdyvdrfyktlraeqasqevknamtetllvqnanpdcktilkal
gpaatleemmtacqgvggpghkarvl

SCOPe Domain Coordinates for d2jo0a1:

Click to download the PDB-style file with coordinates for d2jo0a1.
(The format of our PDB-style files is described here.)

Timeline for d2jo0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jo0a2