Lineage for d1axka1 (1axk A:1-156,A:342-393)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries)
  8. Domain d1axka1: 1axk A:1-156,A:342-393 [24181]
    Other proteins in same PDB: d1axka2, d1axkb2
    interrupted by the insertion of a xylanase domain from Bacillus subtilis
    complexed with ca

Details for d1axka1

PDB Entry: 1axk (more details), 2.1 Å

PDB Description: engineered bacillus bifunctional enzyme gluxyn-1
PDB Compounds: (A:) gluxyn-1

SCOPe Domain Sequences for d1axka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axka1 b.29.1.2 (A:1-156,A:342-393) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans [TaxId: 44252]}
fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
immnlwngtgvddwlgsynganplyaeydwvkytsnXgsvfwepksyfnpstwekadgys
nggvfnctwrannvnftndgklklgltss

SCOPe Domain Coordinates for d1axka1 are not available.

Timeline for d1axka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axka2
View in 3D
Domains from other chains:
(mouse over for more information)
d1axkb1, d1axkb2