![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins) Pfam PF00722 beta-Glucanase-like |
![]() | Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species) |
![]() | Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries) |
![]() | Domain d1axka1: 1axk A:1-156,A:342-393 [24181] Other proteins in same PDB: d1axka2, d1axkb2 interrupted by the insertion of a xylanase domain from Bacillus subtilis complexed with ca |
PDB Entry: 1axk (more details), 2.1 Å
SCOPe Domain Sequences for d1axka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axka1 b.29.1.2 (A:1-156,A:342-393) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans [TaxId: 44252]} fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk immnlwngtgvddwlgsynganplyaeydwvkytsnXgsvfwepksyfnpstwekadgys nggvfnctwrannvnftndgklklgltss
Timeline for d1axka1: