Lineage for d1axka1 (1axk A:1-156,A:342-393)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12660Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins)
  6. 12661Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species)
  7. 12664Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries)
  8. 12671Domain d1axka1: 1axk A:1-156,A:342-393 [24181]
    Other proteins in same PDB: d1axka2, d1axkb2

Details for d1axka1

PDB Entry: 1axk (more details), 2.1 Å

PDB Description: engineered bacillus bifunctional enzyme gluxyn-1

SCOP Domain Sequences for d1axka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axka1 b.29.1.2 (A:1-156,A:342-393) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans}
fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
immnlwngtgvddwlgsynganplyaeydwvkytsnXgsvfwepksyfnpstwekadgys
nggvfnctwrannvnftndgklklgltss

SCOP Domain Coordinates for d1axka1:

Click to download the PDB-style file with coordinates for d1axka1.
(The format of our PDB-style files is described here.)

Timeline for d1axka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axka2