PDB entry 1axk

View 1axk on RCSB PDB site
Description: engineered bacillus bifunctional enzyme gluxyn-1
Class: fusion protein
Keywords: gluxyn-1, bifunctional, fusion protein, 1,4-beta-xylanase, 1,3-1,4-beta-glucanase, hybrid enzyme
Deposited on 1997-10-16, released 1999-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.177
AEROSPACI score: -1.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gluxyn-1
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1axka1, d1axka2
  • Chain 'B':
    Compound: gluxyn-1
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1axkb1, d1axkb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1axkA (A:)
    fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
    qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
    immnlwngtgvddwlgsynganplyaeydwvkytsnastdywqnwtdgggivnavngsgg
    nysvnwsntgnfvvgkgwttgspfrtinynagvwapngngyltlygwtrsplieyyvvds
    wgtyrptgtykgtvksdggtydiytttrynapsidgdrttftqywsvrqskrptgsnati
    tfsnhvnawkshgmnlgsnwayqvmategyqssgssnvtvwgsvfwepksyfnpstweka
    dgysnggvfnctwrannvnftndgklklgltssa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1axkA (A:)
    fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
    qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
    immnlwngtgvddwlgsynganplyaeydwvkytsnastdywqnwtdgggivnavngsgg
    nysvnwsntgnfvvgkgwttgspfrtinynagvwapngngyltlygwtrsplieyyvvds
    wgtyrptgtykgtvksdggtydiytttrynapsidgdrttftqywsvrqskrptgsnati
    tfsnhvnawkshgmnlgsnwayqvmategyqssgssnvtvwgsvfwepksyfnpstweka
    dgysnggvfnctwrannvnftndgklklgltss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axkB (B:)
    fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
    qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
    immnlwngtgvddwlgsynganplyaeydwvkytsnastdywqnwtdgggivnavngsgg
    nysvnwsntgnfvvgkgwttgspfrtinynagvwapngngyltlygwtrsplieyyvvds
    wgtyrptgtykgtvksdggtydiytttrynapsidgdrttftqywsvrqskrptgsnati
    tfsnhvnawkshgmnlgsnwayqvmategyqssgssnvtvwgsvfwepksyfnpstweka
    dgysnggvfnctwrannvnftndgklklgltssa