Lineage for d1axka2 (1axk A:157-341)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries)
  8. Domain d1axka2: 1axk A:157-341 [24315]
    Other proteins in same PDB: d1axka1, d1axkb1
    inserted into a beta-glucanase domain from Bacillus macerans
    complexed with ca

Details for d1axka2

PDB Entry: 1axk (more details), 2.1 Å

PDB Description: engineered bacillus bifunctional enzyme gluxyn-1
PDB Compounds: (A:) gluxyn-1

SCOPe Domain Sequences for d1axka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axka2 b.29.1.11 (A:157-341) Xylanase II {Bacillus subtilis [TaxId: 1423]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOPe Domain Coordinates for d1axka2 are not available.

Timeline for d1axka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axka1
View in 3D
Domains from other chains:
(mouse over for more information)
d1axkb1, d1axkb2