SCOPe 2.08: Domain d2eqza1: 2eqz A:8-86

Lineage for d2eqza1 (2eqz A:8-86)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein automated matches [190434] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187328] (5 PDB entries)

8. Domain d2eqza1: 2eqz A:8-86 [241787]
   Other proteins in same PDB: d2eqza2
   automated match to d1j3xa_

Details for d2eqza1

PDB Entry: 2eqz

PDB Description: solution structure of the first hmg-box domain from high mobility group protein b3

PDB Compounds: (A:) High mobility group protein B3

SCOPe Domain Sequences for d2eqza1:

Sequence; same for both SEQRES and ATOM records:

>d2eqza1 a.21.1.1 (A:8-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
makgdpkkpkgkmsayaffvqtcreehkkknpevpvnfaefskkcserwktmsgkekskf
demakadkvrydremkdyg

Timeline for d2eqza1:

• d2eqza1 first appeared in SCOPe 2.04, called d2eqza_
  
• d2eqza1 appears in SCOPe 2.07