Lineage for d2eqza1 (2eqz A:8-86)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311321Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2311322Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2311323Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2311382Protein automated matches [190434] (3 species)
    not a true protein
  7. 2311391Species Human (Homo sapiens) [TaxId:9606] [187328] (5 PDB entries)
  8. 2311396Domain d2eqza1: 2eqz A:8-86 [241787]
    Other proteins in same PDB: d2eqza2
    automated match to d1j3xa_

Details for d2eqza1

PDB Entry: 2eqz (more details)

PDB Description: solution structure of the first hmg-box domain from high mobility group protein b3
PDB Compounds: (A:) High mobility group protein B3

SCOPe Domain Sequences for d2eqza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eqza1 a.21.1.1 (A:8-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
makgdpkkpkgkmsayaffvqtcreehkkknpevpvnfaefskkcserwktmsgkekskf
demakadkvrydremkdyg

SCOPe Domain Coordinates for d2eqza1:

Click to download the PDB-style file with coordinates for d2eqza1.
(The format of our PDB-style files is described here.)

Timeline for d2eqza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2eqza2