SCOPe 2.04: Domain d2eqza_: 2eqz A:

Lineage for d2eqza_ (2eqz A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein automated matches [190434] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187328] (5 PDB entries)

8. Domain d2eqza_: 2eqz A: [241787]
   automated match to d1j3xa_

Details for d2eqza_

PDB Entry: 2eqz

PDB Description: solution structure of the first hmg-box domain from high mobility group protein b3

PDB Compounds: (A:) High mobility group protein B3

SCOPe Domain Sequences for d2eqza_:

Sequence; same for both SEQRES and ATOM records:

>d2eqza_ a.21.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmakgdpkkpkgkmsayaffvqtcreehkkknpevpvnfaefskkcserwktms
gkekskfdemakadkvrydremkdyg

Timeline for d2eqza_:

• d2eqza_ is new in SCOPe 2.04-stable
  
• d2eqza_ appears in SCOPe 2.05
  
• d2eqza_ appears in the current release, SCOPe 2.08, called d2eqza1