SCOPe 2.07: Domain d2edga1: 2edg A:8-130

Lineage for d2edga1 (2edg A:8-130)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.0: automated matches [191593] (1 protein)
   not a true family

6. Protein automated matches [191080] (7 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255141] (1 PDB entry)

8. Domain d2edga1: 2edg A:8-130 [241729]
   Other proteins in same PDB: d2edga2
   automated match to d3klra_

Details for d2edga1

PDB Entry: 2edg

PDB Description: solution structure of the gcv_h domain from mouse glycine

PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d2edga1:

Sequence; same for both SEQRES and ATOM records:

>d2edga1 b.84.1.0 (A:8-130) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rkftekhewitteegigtvgisnfaqealgdvvycslpevgtklkkqeefgalesvkaas
elysplsgevtevnealaenpglvnkscyedgwlikmtlsdpseldelmseeayekyvks
iee

Timeline for d2edga1:

• d2edga1 first appeared in SCOPe 2.04, called d2edga_
  
• d2edga1 appears in SCOPe 2.06
  
• d2edga1 appears in the current release, SCOPe 2.08