Lineage for d2edga1 (2edg A:8-130)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426782Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2426863Family b.84.1.0: automated matches [191593] (1 protein)
    not a true family
  6. 2426864Protein automated matches [191080] (7 species)
    not a true protein
  7. 2426873Species Mouse (Mus musculus) [TaxId:10090] [255141] (1 PDB entry)
  8. 2426874Domain d2edga1: 2edg A:8-130 [241729]
    Other proteins in same PDB: d2edga2
    automated match to d3klra_

Details for d2edga1

PDB Entry: 2edg (more details)

PDB Description: solution structure of the gcv_h domain from mouse glycine
PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d2edga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2edga1 b.84.1.0 (A:8-130) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rkftekhewitteegigtvgisnfaqealgdvvycslpevgtklkkqeefgalesvkaas
elysplsgevtevnealaenpglvnkscyedgwlikmtlsdpseldelmseeayekyvks
iee

SCOPe Domain Coordinates for d2edga1:

Click to download the PDB-style file with coordinates for d2edga1.
(The format of our PDB-style files is described here.)

Timeline for d2edga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2edga2