Lineage for d3klra_ (3klr A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426782Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2426863Family b.84.1.0: automated matches [191593] (1 protein)
    not a true family
  6. 2426864Protein automated matches [191080] (7 species)
    not a true protein
  7. 2426867Species Cow (Bos taurus) [TaxId:9913] [189360] (2 PDB entries)
  8. 2426869Domain d3klra_: 3klr A: [179430]
    automated match to d1dxma_
    complexed with gol, so4

Details for d3klra_

PDB Entry: 3klr (more details), 0.88 Å

PDB Description: bovine h-protein at 0.88 angstrom resolution
PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d3klra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3klra_ b.84.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svrkftekhewvttengvgtvgisnfaqealgdvvycslpevgtklnkqeefgalesvka
aselysplsgevteinkalaenpglvnkscyedgwlikmtfsnpseldelmseeayekyi
ksiee

SCOPe Domain Coordinates for d3klra_:

Click to download the PDB-style file with coordinates for d3klra_.
(The format of our PDB-style files is described here.)

Timeline for d3klra_: