Lineage for d1dxma_ (1dxm A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426782Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2426783Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2426828Protein Protein H of glycine cleavage system [51236] (4 species)
  7. 2426840Species Pea (Pisum sativum) [TaxId:3888] [51237] (3 PDB entries)
  8. 2426844Domain d1dxma_: 1dxm A: [28223]
    complexed with red

Details for d1dxma_

PDB Entry: 1dxm (more details), 2.6 Å

PDB Description: reduced form of the h protein from glycine decarboxylase complex
PDB Compounds: (A:) h protein

SCOPe Domain Sequences for d1dxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxma_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]}
snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
tkfceeedaah

SCOPe Domain Coordinates for d1dxma_:

Click to download the PDB-style file with coordinates for d1dxma_.
(The format of our PDB-style files is described here.)

Timeline for d1dxma_: