SCOPe 2.01: Domain d3klra_: 3klr A:

Lineage for d3klra_ (3klr A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.0: automated matches [191593] (1 protein)
   not a true family

6. Protein automated matches [191080] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [189360] (1 PDB entry)

8. Domain d3klra_: 3klr A: [179430]
   automated match to d1dxma_
   complexed with gol, so4

Details for d3klra_

PDB Entry: 3klr, 0.88 Å

PDB Description: bovine h-protein at 0.88 angstrom resolution

PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d3klra_:

Sequence; same for both SEQRES and ATOM records:

>d3klra_ b.84.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svrkftekhewvttengvgtvgisnfaqealgdvvycslpevgtklnkqeefgalesvka
aselysplsgevteinkalaenpglvnkscyedgwlikmtfsnpseldelmseeayekyi
ksiee

Timeline for d3klra_:

• d3klra_ is new in SCOPe 2.01-stable
  
• d3klra_ appears in SCOPe 2.02
  
• d3klra_ appears in the current release, SCOPe 2.08