PDB entry 2edg

View 2edg on RCSB PDB site
Description: Solution structure of the GCV_H domain from mouse glycine
Class: biosynthetic protein
Keywords: Barrel-sandwich hybrid, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, BIOSYNTHETIC PROTEIN
Deposited on 2007-02-14, released 2007-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glycine cleavage system H protein
  Species: Mus musculus [TaxId:10090]
  Gene: Gcsh
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q91WK5 (7-129)
    • cloning artifact (0-6)
  Domains in SCOPe 2.07: d2edga1, d2edga2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2edgA (A:)
  gssgssgrkftekhewitteegigtvgisnfaqealgdvvycslpevgtklkkqeefgal
  esvkaaselysplsgevtevnealaenpglvnkscyedgwlikmtlsdpseldelmseea
  yekyvksiee