| Class b: All beta proteins [48724] (176 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.0: automated matches [191593] (1 protein) not a true family |
| Protein automated matches [191080] (7 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [255141] (1 PDB entry) |
| Domain d2edga_: 2edg A: [241729] automated match to d3klra_ |
PDB Entry: 2edg (more details)
SCOPe Domain Sequences for d2edga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2edga_ b.84.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgrkftekhewitteegigtvgisnfaqealgdvvycslpevgtklkkqeefgal
esvkaaselysplsgevtevnealaenpglvnkscyedgwlikmtlsdpseldelmseea
yekyvksiee
Timeline for d2edga_: