SCOPe 2.04: Domain d2edga_: 2edg A:

Lineage for d2edga_ (2edg A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.0: automated matches [191593] (1 protein)
   not a true family

6. Protein automated matches [191080] (7 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255141] (1 PDB entry)

8. Domain d2edga_: 2edg A: [241729]
   automated match to d3klra_

Details for d2edga_

PDB Entry: 2edg

PDB Description: solution structure of the gcv_h domain from mouse glycine

PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d2edga_:

Sequence; same for both SEQRES and ATOM records:

>d2edga_ b.84.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgrkftekhewitteegigtvgisnfaqealgdvvycslpevgtklkkqeefgal
esvkaaselysplsgevtevnealaenpglvnkscyedgwlikmtlsdpseldelmseea
yekyvksiee

Timeline for d2edga_:

• d2edga_ is new in SCOPe 2.04-stable
  
• d2edga_ appears in SCOPe 2.05
  
• d2edga_ appears in the current release, SCOPe 2.08, called d2edga1