Lineage for d1bzwc_ (1bzw C:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Lectin [49904] (15 species) 
Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (5 PDB entries) 
Domain d1bzwc_: 1bzw C: [24100]
Details for d1bzwc_
PDB Entry: 1bzw (more details), 2.7 Å
PDB Description: peanut lectin complexed with c-lactose
SCOP Domain Sequences for d1bzwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzwc_ b.29.1.1 (C:) Lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
SCOP Domain Coordinates for d1bzwc_:
Click to download the PDB-style file with coordinates for d1bzwc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bzwc_:
- d1bzwc_ appears in SCOP 1.57
- d1bzwc_ appears in the current release, SCOPe 2.08
View in 3D
