PDB entry 1bzw

View 1bzw on RCSB PDB site
Description: peanut lectin complexed with c-lactose
Deposited on 1998-11-05, released 1998-11-11
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bzwa_
  • Chain 'B':
    Domains in SCOP 1.55: d1bzwb_
  • Chain 'C':
    Domains in SCOP 1.55: d1bzwc_
  • Chain 'D':
    Domains in SCOP 1.55: d1bzwd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzwA (A:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzwB (B:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzwC (C:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzwD (D:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt