Lineage for d1vrva_ (1vrv A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599665Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1599779Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. 1599780Family c.44.2.1: PTS system, Lactose/Cellobiose specific IIB subunit [52795] (3 proteins)
    Pfam PF02302
  6. 1599790Protein automated matches [254437] (1 species)
    not a true protein
  7. 1599791Species Escherichia coli [TaxId:83334] [254923] (2 PDB entries)
  8. 1599792Domain d1vrva_: 1vrv A: [240784]
    automated match to d1vkra_

Details for d1vrva_

PDB Entry: 1vrv (more details)

PDB Description: structure of phosphorylated iib (c384(sep)) domain of the mannitol- specific permease enzyme ii
PDB Compounds: (A:) mannitol-specific PTS system enzyme IIABC components

SCOPe Domain Sequences for d1vrva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrva_ c.44.2.1 (A:) automated matches {Escherichia coli [TaxId: 83334]}
shvrkiivasdagmgssamgagvlrkkiqdaglsqisvtnsainnlppdvdlvithrdlt
eramrqvpqaqhisltnfldsglytslterlvaaqrh

SCOPe Domain Coordinates for d1vrva_:

Click to download the PDB-style file with coordinates for d1vrva_.
(The format of our PDB-style files is described here.)

Timeline for d1vrva_: