Lineage for d1vrva_ (1vrv A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. Family c.44.2.1: PTS system, Lactose/Cellobiose specific IIB subunit [52795] (3 proteins)
    Pfam PF02302
  6. Protein automated matches [254437] (1 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83334] [254923] (2 PDB entries)
  8. Domain d1vrva_: 1vrv A: [240784]
    automated match to d1vkra_

Details for d1vrva_

PDB Entry: 1vrv (more details)

PDB Description: Structure of phosphorylated IIB (C384(SEP)) domain of the mannitol-specific permease enzyme II
PDB Compounds: (A:) mannitol-specific PTS system enzyme IIABC components

SCOPe Domain Sequences for d1vrva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrva_ c.44.2.1 (A:) automated matches {Escherichia coli [TaxId: 83334]}
shvrkiivasdagmgssamgagvlrkkiqdaglsqisvtnsainnlppdvdlvithrdlt
eramrqvpqaqhisltnfldsglytslterlvaaqrh

SCOPe Domain Coordinates for d1vrva_ are not available.

Timeline for d1vrva_: